PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC1334_p5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Whirly
Protein Properties Length: 233aa    MW: 25347.6 Da    PI: 9.6474
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC1334_p5genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly107.21.4e-3392165174
      Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesc 74 
                 s+yk+kaal+v++++p+f++ldsg++kl+++G+lll++a+a+++r+ydW+kkq+f+ls+ e+++lv+l+++esc
  RrC1334_p5  92 SIYKGKAALTVEPRAPEFVSLDSGAFKLSKDGFLLLQFAPAAGVRQYDWSKKQVFSLSVSEIGTLVSLGPRESC 165
                 7************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.105.9E-3682165IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544472.59E-5786233IPR009044ssDNA-binding transcriptional regulator
PfamPF085363.9E-2993166IPR013742Plant transcription factor
Gene3DG3DSA:2.30.31.104.5E-15166215IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 233 aa     Download sequence    Send to blast
MSQLLSSPLM AASYNPFASP RFLSSSSSVL VPGGGGGLAV KWHGLASKPA RTVNLSVKSR  60
QTDYFEKQRF GDSSSSSQNG EGGPARFYVG HSIYKGKAAL TVEPRAPEFV SLDSGAFKLS  120
KDGFLLLQFA PAAGVRQYDW SKKQVFSLSV SEIGTLVSLG PRESCVQNKL LNVDESIYIP  180
ITRAEFTVLV SAFNFVLPYL IGWHAFANSI KPEETIRTNN ASSNYGGDYE WNR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4koo_D5e-80802112169Single-stranded DNA-binding protein WHY1, chl
4koo_C5e-80802112169Single-stranded DNA-binding protein WHY1, chl
4koo_B5e-80802112169Single-stranded DNA-binding protein WHY1, chl
4koo_A5e-80802112169Single-stranded DNA-binding protein WHY1, chl
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3324521e-103AF332452.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds.
GenBankAF3701561e-103AF370156.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds.
GenBankAY0590971e-103AY059097.1 Arabidopsis thaliana putative DNA-binding protein p24 (At1g14410) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009110543.11e-141PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
SwissprotQ9M9S31e-128WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLM4DJM41e-141M4DJM4_BRARP; Uncharacterized protein
STRINGBra016702.1-P1e-140(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50232752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.11e-121ssDNA-binding transcriptional regulator